SMART: PDB domain 2zg3

The domain within your query sequence starts at position 24 and ends at position 185; the E-value for the 2zg3 domain shown below is 9e-7.

KKTAMEDGLCSMVPCVIEFYKAPFRNPMAVSYRLNENISFRVGTSHPSAPMGDLSTEEVE
YCILMTHSMLRRKYMTNSLYVGLGTQKDLTQNPELHIPESSVAGEPVTLSCTIQSTCQEP
NALFLSWKGPIMSSNTTISIHPSSALAIELKPEDQGTTLRCH

The domain within your query sequence starts at position 24 and ends at position 185; the E-value for the 2zg3 domain shown below is 9e-7.

This is a PDB domain - please see the PDBSUM entry of 2zg3 for further annotation